DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33752

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:156 Identity:58/156 - (37%)
Similarity:90/156 - (57%) Gaps:8/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYNVTI 92
            |:||..||..||:|..|.|..:.|.....|:.:|.|:.||.||.:|..:.::|:||.|||:|||:
  Fly    28 NVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFLFNVTV 92

  Fly    93 DACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYD-----HDIIVEKLPISHVNTQVTKVLPVPH 152
            |.|.:.|:.....|..|.|:..|.|||.||||||:     |||:|:...::  :|...|: |:|.
  Fly    93 DFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLT--DTMFAKI-PLPT 154

  Fly   153 GDYLFHSNWYAYDINRAIVDVYATIS 178
            |:|:|.......|:.|.:::.|..::
  Fly   155 GNYMFSIKLATDDVWRVVLNTYFDVN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 36/89 (40%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 36/89 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472190
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.