DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33453

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:164 Identity:59/164 - (35%)
Similarity:91/164 - (55%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SIFLYSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVA 75
            ::||.|.......::..|:.|.:::..:|.|.||.|||.||....|::....|. |...:.:.:.
  Fly    14 ALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNNVSLRLK 77

  Fly    76 ILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHV 140
            :::||:||||||::||||||:|.: ::.||:.:..|||.||||.:||:|||...:      :|..
  Fly    78 MVKRLSGYKPFLFDVTIDACQFLR-KRHNPVIKMFYSFIKDYSTLNHTCPYGLQV------VSDY 135

  Fly   141 NTQVTKVLPVPHGDY------------LFHSNWY 162
            :|.|..| |:|.|||            .||.|.|
  Fly   136 HTAVFPV-PLPSGDYGVLLDFIFYAKKQFHVNIY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 38/96 (40%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472429
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.