DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33475

DIOPT Version :10

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:119 Identity:26/119 - (21%)
Similarity:49/119 - (41%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CVTLDPEF--ADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYNV-TI 92
            |:.|:.::  ::.||..| ....:.|.:....||.:......:|..|:..|.      :||: .:
  Fly     5 CLGLELKYNRSNVDYFGL-VPGESQKMMINSTKLFKNIFLDNRIQNAVSNRT------IYNIKNL 62

  Fly    93 DACKFYKNQKSNPIARYLYSFFKDYSNINHSCP------YDHDIIVE-KLPISH 139
            ..|.|..|:..:.:...:|..|...|.: ..||      |..:.:.| ::||.|
  Fly    63 AICNFLNNRLISKVYSVIYEGFVGNSTV-FRCPVQPSVYYLSNSVREFEVPIFH 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 18/76 (24%)
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 16/71 (23%)

Return to query results.
Submit another query.