DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG30050

DIOPT Version :10

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:134 Identity:26/134 - (19%)
Similarity:48/134 - (35%) Gaps:38/134 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFL- 87
            :|...:.||.....||:. ||                :::......::.:|.|:|:|:.:...| 
  Fly    31 IEMKQMDCVGNPNYFANL-YC----------------RIIPPKNRTMEASVNIMQQLSVFSGSLR 78

  Fly    88 -------------YNVTIDACKFYKNQKSNPIARYLYSFFKDYSNIN-HSCPY------DHDIIV 132
                         :::|.|.||..:.:|...:...|.:.....||.. ..||:      ..:|.|
  Fly    79 VSIPNAKKVITQIFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISV 143

  Fly   133 EKLP 136
            ..||
  Fly   144 TDLP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 19/86 (22%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 14/58 (24%)

Return to query results.
Submit another query.