DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-218 and Mcm3

DIOPT Version :9

Sequence 1:NP_001027068.1 Gene:mei-218 / 3772646 FlyBaseID:FBgn0002709 Length:1186 Species:Drosophila melanogaster
Sequence 2:NP_511048.2 Gene:Mcm3 / 31449 FlyBaseID:FBgn0284442 Length:819 Species:Drosophila melanogaster


Alignment Length:386 Identity:70/386 - (18%)
Similarity:120/386 - (31%) Gaps:117/386 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   804 APSQHGQEYPKPDLNCVPSSIKKLHHLISSQYSDYSFVYALSAQISQDCVPMDCFVYLKMILLAS 868
            |||.||..|.|..:.|                                            :||..
  Fly   299 APSIHGHAYVKQAILC--------------------------------------------LLLGG 319

  Fly   869 IVSI--ESDEVRAPISLCIIATDSLMANRLLNKVGQLAPRFL-----GPHEYGLQPTFNA-LPTR 925
            :..|  ....:|..|::.:|...|:..::||..|...|||.:     |....||...... ..|.
  Fly   320 VEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETG 384

  Fly   926 FNWIVASPLLLAQQGVYYAGDWNRLSKDQGCQLEKCIENGAVPVPQLHIDQPLKAAVWT------ 984
            ...:.|..::||.:||....:::::|......:.:.:|.|.|.:.:..|...|.|....      
  Fly   385 ERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANP 449

  Fly   985 -------YWQP-NNSTNQTLALAKLCPIF-------------------------------GLPIY 1010
                   |..| .|...|...|::...:|                               |.|:.
  Fly   450 VYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLS 514

  Fly  1011 MGAQASNSLW----------NSIIQKHNA--EGQIVVNDGLSIPEDDMRMLIHLLHQRKTTLTDG 1063
            ||:..::||.          ..:.:|::|  .|:........:..:.||..||:....|..|.:.
  Fly   515 MGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQ 579

  Fly  1064 AQHMLQKYYVISRKE--------RPNVFSSKTYIVLKQLAECFAKLALRLEVLESDVCVAI 1116
            |...:...|...|.:        |....:::|...|.:|:...|:..:...|...|...||
  Fly   580 ACEAIANEYSRLRSQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAI 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-218NP_001027068.1 PTZ00112 122..>417 CDD:240274
MCM <1023..1116 CDD:278895 19/102 (19%)
Mcm3NP_511048.2 MCM_N 18..101 CDD:379644
MCM 106..648 CDD:214631 70/386 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11630
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.