DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and SLC25A33

DIOPT Version :10

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_115691.1 Gene:SLC25A33 / 84275 HGNCID:29681 Length:321 Species:Homo sapiens


Alignment Length:31 Identity:11/31 - (35%)
Similarity:17/31 - (54%) Gaps:6/31 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IALLVNSLHLLVLIRKPLRCCGIFIFMLAIC 48
            :.||..|.:||.|::..||.      ::|||
Human   203 LGLLPISFNLLSLLQAVLRA------IIAIC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:395101 3/10 (30%)
Mito_carr 178..265 CDD:395101
Mito_carr 268..371 CDD:395101
SLC25A33NP_115691.1 Mito_carr 7..123 CDD:395101
Solcar 1 9..118
Mito_carr 125..216 CDD:395101 5/12 (42%)
Solcar 2 126..213 3/9 (33%)
Solcar 3 231..315
Mito_carr 232..312 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.