| Sequence 1: | NP_001027071.1 | Gene: | Shawn / 3772641 | FlyBaseID: | FBgn0031039 | Length: | 387 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_115691.1 | Gene: | SLC25A33 / 84275 | HGNCID: | 29681 | Length: | 321 | Species: | Homo sapiens |
| Alignment Length: | 31 | Identity: | 11/31 - (35%) |
|---|---|---|---|
| Similarity: | 17/31 - (54%) | Gaps: | 6/31 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 IALLVNSLHLLVLIRKPLRCCGIFIFMLAIC 48 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Shawn | NP_001027071.1 | Mito_carr | 39..159 | CDD:395101 | 3/10 (30%) |
| Mito_carr | 178..265 | CDD:395101 | |||
| Mito_carr | 268..371 | CDD:395101 | |||
| SLC25A33 | NP_115691.1 | Mito_carr | 7..123 | CDD:395101 | |
| Solcar 1 | 9..118 | ||||
| Mito_carr | 125..216 | CDD:395101 | 5/12 (42%) | ||
| Solcar 2 | 126..213 | 3/9 (33%) | |||
| Solcar 3 | 231..315 | ||||
| Mito_carr | 232..312 | CDD:395101 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||