DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and Slc25a39

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_080818.1 Gene:Slc25a39 / 68066 MGIID:1196386 Length:359 Species:Mus musculus


Alignment Length:371 Identity:149/371 - (40%)
Similarity:205/371 - (55%) Gaps:57/371 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLS-----------------------NK 78
            |.||||:.::..||:||:.|||||||:|.|||:|:.:..|                       .|
Mouse     9 ISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPSATSELTTPSRFWSLSYTKSSSALQSPGK 73

  Fly    79 CFLYCNGLMD--HICP----CGPDTPNPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLI 137
            |.|||||:::  ::||    |.....:|.      ||:||:|||:||.|.||..:|||||..||:
Mouse    74 CLLYCNGVLEPLYLCPNGTRCATWFQDPT------RFTGTLDAFVKIVRHEGTRTLWSGLPATLV 132

  Fly   138 SALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPV 202
            ..:|:|.|||.||:|.||....         .::..|:      ..|::||...|:..||.|||:
Mouse   133 MTVPATAIYFTAYDQLKAFLCG---------QSLTSDL------YAPMVAGALARMGTVTVVSPL 182

  Fly   203 ELIRTKMQSQRMTHAEMFGTIRQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSFGVV 267
            ||:|||:|:|.:::.|:..:::..|...|...||.|..||.|||||||.:||..||.:||....:
Mouse   183 ELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLSGL 247

  Fly   268 EP----TFSFSFAAGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLAS 328
            .|    :...||.||.|||.||||:|.|||||||..|:..|........||:   ..|..:.|..
Mouse   248 RPKDQTSVGISFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAVRVKPPR---VDSTWLLLRR 309

  Fly   329 IYRMGGVPAIFSGLGPRLFKVAPACAIMISSFEYGKSFFYHYNIDQ 374
            |....|...:|:|..||:.|.||:||||||::|:|||||...|.:|
Mouse   310 IRAESGTRGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQEQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 61/148 (41%)
Mito_carr 178..265 CDD:278578 37/86 (43%)
Mito_carr 268..371 CDD:278578 47/106 (44%)
Slc25a39NP_080818.1 Mito_carr 9..152 CDD:365909 62/148 (42%)
Solcar 1 9..151 61/147 (41%)
CLIP_SPH_mas 71..94 CDD:375824 9/22 (41%)
Solcar 2 159..243 37/89 (42%)
Mito_carr 161..246 CDD:365909 37/90 (41%)
Solcar 3 253..347 43/96 (45%)
Mito_carr 254..350 CDD:365909 46/98 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7902
eggNOG 1 0.900 - - E1_KOG0761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 294 1.000 Inparanoid score I2730
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53824
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001594
OrthoInspector 1 1.000 - - mtm8854
orthoMCL 1 0.900 - - OOG6_101405
Panther 1 1.100 - - O PTHR45760
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2199
SonicParanoid 1 1.000 - - X1001
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.