DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and CG1907

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:381 Identity:83/381 - (21%)
Similarity:138/381 - (36%) Gaps:81/381 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MAAASSQN-PSKATMTDPRFRIRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCF 80
            |:|.|.|. |.||..|:   .|:.|....|.....||    :.|||::|||:|..          
  Fly     1 MSATSVQEAPKKAVATN---AIKFLFGGLSGMGATMV----VQPLDLVKTRMQIS---------- 48

  Fly    81 LYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTII 145
                                .|......:..::.....|...||..:|:.|:...|:.....|..
  Fly    49 --------------------GAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTG 93

  Fly   146 YFVAYEQFKARFTDIHYKYTRRP---DTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRT 207
            ....|......|.:   |:.|.|   |::|          :..:||..|..:.    :|.|:...
  Fly    94 RLGMYTYLNDLFRE---KFQRSPGITDSMA----------MGTIAGACGAFIG----TPAEVALV 141

  Fly   208 KMQS-------QRMTHAEMFGTIRQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSFG 265
            :|.|       :|..:..:...:.::.:.:|:..||||..||:.|.:..:......|...|:.|.
  Fly   142 RMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFR 206

  Fly   266 ----VVEPTFSFSFAAGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRL 326
                .:|......|.|..:||.:....:.|.|:.||..|   ..|.:  |..|:...|..|.:|:
  Fly   207 HGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQ---NMKMV--DGKPEYRGTADVLLRV 266

  Fly   327 ASIYRMGGVPAIFSGLGPRLFKVAPACAIMISSFEYGKSFFYHYNIDQHNRSNQAT 382
            |   |..||.|::.|..|...::.|...:.....|.....:..|.:.    ||::|
  Fly   267 A---RQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLG----SNKST 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 21/119 (18%)
Mito_carr 178..265 CDD:278578 18/93 (19%)
Mito_carr 268..371 CDD:278578 25/102 (25%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 23/132 (17%)
Mito_carr 118..207 CDD:278578 20/102 (20%)
Mito_carr 219..307 CDD:278578 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.