DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and CG5805

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:349 Identity:71/349 - (20%)
Similarity:125/349 - (35%) Gaps:96/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAA 103
            ||..::|     ....|.:.||.||||:||.|.::.:                            
  Fly    44 PLSMLSS-----FSVRCCLFPLTVIKTQLQVQHKSDV---------------------------- 75

  Fly   104 KPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRP 168
                 :.|.:|..:||.|:||:..|:.|...:.:. :.|.:.|...||..:....|:...:..: 
  Fly    76 -----YKGMVDCAMKIYRSEGVPGLYRGFWISSVQ-IVSGVFYISTYEGVRHVLNDLGAGHRMK- 133

  Fly   169 DTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMT-HAEMFGTI--------- 223
                           .|..|....::..|.:.|.::|........|: ||...|.|         
  Fly   134 ---------------ALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWP 183

  Fly   224 ------------RQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYE-YLKSSFGVVEPTFSFSF 275
                        |::::..|..|.:||...:::..||.|.::|..|. |....|.:.....|..|
  Fly   184 GRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRICPVWVSHLF 248

  Fly   276 ---AAGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPA 337
               .||::.|.....:|.|.|:|:...|:.             ::.:.|||.|  .:::...:..
  Fly   249 IQCVAGSLGGFTTTILTNPLDIVRARLQVH-------------RLDSMSVAFR--ELWQEEKLNC 298

  Fly   338 IFSGLGPRLFKVAPACAIMISSFE 361
            .|.||..||.:.|.....:|..:|
  Fly   299 FFKGLSARLVQSAAFSFSIILGYE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 26/119 (22%)
Mito_carr 178..265 CDD:278578 21/109 (19%)
Mito_carr 268..371 CDD:278578 22/97 (23%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 24/117 (21%)
Mito_carr 132..238 CDD:395101 21/121 (17%)
Mito_carr 245..327 CDD:395101 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.