DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and CG46441

DIOPT Version :10

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001369026.1 Gene:CG46441 / 42423 FlyBaseID:FBgn0287211 Length:96 Species:Drosophila melanogaster


Alignment Length:37 Identity:11/37 - (29%)
Similarity:14/37 - (37%) Gaps:17/37 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LLSNKC--------FLYCNG--------LMDHICPCG 94
            :|.|.|        :||.|.        |||: |..|
  Fly    36 ILLNACLIALAFPLYLYLNSVDEVVKKRLMDY-CIVG 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:395101 11/37 (30%)
Mito_carr 178..265 CDD:395101
Mito_carr 268..371 CDD:395101
CG46441NP_001369026.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.