DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and Dic4

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:331 Identity:66/331 - (19%)
Similarity:125/331 - (37%) Gaps:94/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTID 114
            :|..|..:.|:|::||.:|.|:|    .:..|                             ||:.
  Fly    30 SMCVAFAVAPIDIVKTHMQIQRQ----KRSIL-----------------------------GTVK 61

  Fly   115 AFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHPI 179
               :|...:|....:.|.|..::..:.||.|:|:.|:      |....:|..|...:.       
  Fly    62 ---RIHSLKGYLGFYDGFSAAILRQMTSTNIHFIVYD------TGKKMEYVDRDSYLG------- 110

  Fly   180 PFLVPLLAGVSGRILAVTCVSPVELIRTKMQS-------QRMTHAEMFGTIRQVVQSQGVLGLWR 237
            ..::..:||..|....:    |.:||..:||:       :|..:..:|..:.::.:.:|...|::
  Fly   111 KIILGCVAGACGSAFGI----PTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYK 171

  Fly   238 GLPPTILRDVPFSGIYWTC-----YEYLKSSFGVVEPTFSFS------FAAGAISGSVAATITTP 291
            |....:     |.....||     |:.:|:.   |....|.:      |.....:..:::.||.|
  Fly   172 GGSVAV-----FKSSLSTCSQIAFYDIIKTE---VRKNISVNDGLPLHFLTSLGTSIISSAITHP 228

  Fly   292 FDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMG-GVPAIFSGLGPRLFKVAPACAI 355
            .|||:|          |..::.|.:..|    :..||::.|. ||...:.|..|.:.:.|||..:
  Fly   229 LDVVRT----------IMMNSRPGEFRT----VFQASVHMMRFGVMGPYRGFVPTIVRKAPATTL 279

  Fly   356 MISSFE 361
            :...:|
  Fly   280 LFVLYE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 21/108 (19%)
Mito_carr 178..265 CDD:278578 18/98 (18%)
Mito_carr 268..371 CDD:278578 23/101 (23%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 66/331 (20%)
Mito_carr 26..100 CDD:278578 22/111 (20%)
Mito_carr 104..201 CDD:278578 20/115 (17%)
Mito_carr 211..292 CDD:278578 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.