DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and CG7514

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:336 Identity:70/336 - (20%)
Similarity:127/336 - (37%) Gaps:66/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTIDA 115
            |:..|.:.|||::|||:|                                 .:.....:..:.|.
  Fly    24 MLGTCIVQPLDLVKTRMQ---------------------------------ISATTGEYKSSFDC 55

  Fly   116 FIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHPIP 180
            .:|:.:.|||.:|::|||    :.|.....|..|...|.....|.:.|....|.|:...:.    
  Fly    56 LLKVFKNEGILALYNGLS----AGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMG---- 112

  Fly   181 FLVPLLAGVSGRILAVTCVSPVELIRTKMQS-------QRMTHAEMFGTIRQVVQSQGVLGLWRG 238
              :.:|||..|.:..    :|.|:...:|.|       :|..:..:.....::|:.:||:.||:|
  Fly   113 --MGILAGAFGAMFG----NPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKG 171

  Fly   239 LPPTILRDVPFSGIYWTCYEYLKSSFGVVEPTFSFSFAAGAISGSVAATITTPFDVVKTHEQIEF 303
            ..||:.|.:..:.:....|..||::|.......|...||..:||.:....:.|.|:.||..|   
  Fly   172 CMPTVGRAMIVNMVQLASYSQLKAAFSEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQ--- 233

  Fly   304 GEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAPACAIMISSFEYGKSFFY 368
                  .....:...|..|.|:::   :..|:.:::.|..|.|.::.|.........|.....:.
  Fly   234 ------QQKTAEYKGTMDVLMKVS---KNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYK 289

  Fly   369 HYNIDQHNRSN 379
            |..:...:.||
  Fly   290 HIVLGDDSESN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 22/107 (21%)
Mito_carr 178..265 CDD:278578 21/93 (23%)
Mito_carr 268..371 CDD:278578 20/102 (20%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 67/321 (21%)
Mito_carr 19..90 CDD:278578 21/102 (21%)
Mito_carr 104..201 CDD:278578 24/106 (23%)
Mito_carr 207..284 CDD:278578 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.