DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and PMP34

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:337 Identity:76/337 - (22%)
Similarity:131/337 - (38%) Gaps:73/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAP 107
            |:.|..|.:..:.|. |||.:::|||.::                                  |.
  Fly    20 VSGAAGGCIAMSTFY-PLDTVRSRLQLEE----------------------------------AG 49

  Fly   108 RFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIA 172
            ....|.....:|...||..||:.||.|.|.|...|..:||..:...||              ..:
  Fly    50 DVRSTRQVIKEIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKA--------------VAS 100

  Fly   173 HDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMT---------HAEMFGTIRQVVQ 228
            ...|.....|..||.|....|:.|...:|..::.|:::.:.:.         :..:...::.|.:
  Fly   101 GGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAE 165

  Fly   229 SQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSF----GVVEPTFSFSFAAGAISGSVAATIT 289
            .:|:.|||.|..|:::. |....:.:..||.||.:.    |....:.|| |..|||:.:.|..:|
  Fly   166 KEGIAGLWSGTIPSLML-VSNPALQFMMYEMLKRNIMRFTGGEMGSLSF-FFIGAIAKAFATVLT 228

  Fly   290 TPFDVVKTHEQIEFGEKFIFSDNPPKQVA-----TKSVAMRLASIYRMGGVPAIFSGLGPRLFKV 349
            .|..:|:|.::....|    ||:.|...|     |:|....:.||.:..|:..:|.||..::.:.
  Fly   229 YPLQLVQTKQRHRSKE----SDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQT 289

  Fly   350 APACAIMISSFE 361
            ....|:|..::|
  Fly   290 VLTAALMFMAYE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 27/115 (23%)
Mito_carr 178..265 CDD:278578 20/99 (20%)
Mito_carr 268..371 CDD:278578 27/99 (27%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 25/110 (23%)
Mito_carr 105..202 CDD:278578 20/97 (21%)
Mito_carr 214..303 CDD:278578 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.