DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and Tpc2

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:347 Identity:82/347 - (23%)
Similarity:144/347 - (41%) Gaps:61/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPA 101
            ::.:|.|.....|| .|.....||||:|.|.|.|.:.:.::|                       
  Fly     8 VQLMQAVGGGIAGA-ATRTITQPLDVLKIRFQMQVEPVTNHK----------------------- 48

  Fly   102 AAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTR 166
                ..::.|.|.||..:...||:..::.|.:...:.::...::.|.:|||.::......|...|
  Fly    49 ----GSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRER 109

  Fly   167 RPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKM----QSQRMTHAEMFGTIRQVV 227
                         |||:..:.|.....|......|.:::||:|    .|.|.:....|..:|:|.
  Fly   110 -------------PFLMFFICGGIAGCLGAVAAQPFDVVRTQMVAADPSSRRSQMNTFTGLRKVY 161

  Fly   228 QSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSFGVVEPT-------FSFSFAAGAISGSVA 285
            :.:|.:||.||||.|:::..|..|..:..|:||.::..:.:|.       .:|.|..||:||.:|
  Fly   162 KMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLA 226

  Fly   286 ATITTPFDVVKTHEQIEF--GEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFK 348
            ..|..|.|::|...|:..  .|:..|..||    ...::...:.:.:|..|:...:.|:.|.|.|
  Fly   227 KMIVYPADLLKKRIQLMAFKQERKTFGRNP----ECPTILGCITTTFREEGIGGFYKGMLPTLLK 287

  Fly   349 VAPACAIMISSFEYGKSFFYHY 370
            .....|:..|.::   .|..||
  Fly   288 AGLMSAVYFSIYD---MFKRHY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/119 (21%)
Mito_carr 178..265 CDD:278578 27/90 (30%)
Mito_carr 268..371 CDD:278578 28/112 (25%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 76/327 (23%)
Mito_carr 23..99 CDD:278578 21/102 (21%)
Mito_carr 108..194 CDD:278578 26/98 (27%)
Mito_carr 216..307 CDD:278578 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.