DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and CG18324

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:330 Identity:72/330 - (21%)
Similarity:118/330 - (35%) Gaps:65/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGT 112
            |.||....|..|:||:|||:|.|.:        |...|               ...||   :...
  Fly    11 TAAMGAVVFTNPIDVVKTRMQLQGE--------LAARG---------------TYVKP---YRHL 49

  Fly   113 IDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPH 177
            ..|.::|...:|:.:|..||:|.|........:....|.      ..:...|.:..|       .
  Fly    50 PQAMLQIVLNDGLLALEKGLAPALCYQFVLNSVRLSVYS------NALELGYLQNAD-------G 101

  Fly   178 PIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRM---------THAEMFGTIRQVVQSQGVL 233
            .|.|...:..|..|........||..:|:.:..:|.:         .|..|...:..:.::.|:.
  Fly   102 SISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGIS 166

  Fly   234 GLWRGLPPTILRDVPFS----GIYWTCYEYLKSSFGVVEPTFSFSFAAGAISGSVAATITTPFDV 294
            |.||...|::.|.:..|    |.:......||....:..|.. .||.||..||::.|...:||||
  Fly   167 GFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDKGWITHPVL-LSFCAGLSSGTLVAVANSPFDV 230

  Fly   295 VKTHEQIEFGEKFIFS---DNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAPACAIM 356
            :.|.         :::   |...:.:..|.:......|:|..|:..::.|..|..|:.||...:.
  Fly   231 LTTR---------MYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLT 286

  Fly   357 ISSFE 361
            ...||
  Fly   287 FVFFE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/110 (23%)
Mito_carr 178..265 CDD:278578 20/99 (20%)
Mito_carr 268..371 CDD:278578 25/97 (26%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 24/101 (24%)
PTZ00169 5..293 CDD:240302 72/330 (22%)
Mito_carr 101..201 CDD:278578 20/99 (20%)
Mito_carr 204..296 CDD:278578 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.