DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and CG8323

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:336 Identity:85/336 - (25%)
Similarity:138/336 - (41%) Gaps:80/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AMVTACFMT-PLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTI 113
            |.|.|.|.| |::|||||:|.|.:        |...|  .::.|                :.|.:
  Fly    12 ASVGATFFTNPIEVIKTRIQLQGE--------LAARG--TYVEP----------------YKGIV 50

  Fly   114 DAFIKISRTEGIGSLWSGLSPTL-----ISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAH 173
            :|||.:::.:||..|..||:|.|     |::...: ||..|.|:        .:.:.|:.:    
  Fly    51 NAFITVAKNDGITGLQKGLAPALYFQFIINSFRLS-IYSEAMER--------RWMHNRKGE---- 102

  Fly   174 DIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQ---------RMTHAEMFGTIRQVVQS 229
                 :.:.:.||.|..|.::.....||..||:|::|||         :..|..|...:||:...
  Fly   103 -----VSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSR 162

  Fly   230 QGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSFG----VVEPTFSFSFAAGAISGSVAATITT 290
            .||.|||||....:.|....||.....:...|:...    |.:||.: ||:||.|:||:.:...|
  Fly   163 NGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQYDLVTQPTLN-SFSAGLIAGSIMSVAIT 226

  Fly   291 PFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMR-----LASIYRMGGVPAIFSGLGPRLFKVA 350
            |.||:.|...           |.......:.:..|     ...|.|..||..::.|......::|
  Fly   227 PPDVITTRLY-----------NQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIA 280

  Fly   351 PACAIMISSFE 361
            |...:::..|:
  Fly   281 PHSTLVLLFFD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 32/114 (28%)
Mito_carr 178..265 CDD:278578 27/95 (28%)
Mito_carr 268..371 CDD:278578 24/99 (24%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 28/101 (28%)
PTZ00169 5..293 CDD:240302 85/336 (25%)
Mito_carr 101..200 CDD:278578 27/107 (25%)
Mito_carr 206..301 CDD:278578 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.