DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and CG4995

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:321 Identity:78/321 - (24%)
Similarity:123/321 - (38%) Gaps:95/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTIDAFIKISRTE 123
            |.|.:|..||.                          |.|.      .|::.||...|..|.:.:
  Fly    60 PFDTVKVHLQT--------------------------DDPR------NPKYKGTFHCFRTIVQRD 92

  Fly   124 GIGSLWSGLSPT-----LISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTI-AHDIPHPIPFL 182
            ....|:.|:|..     |::|     |.|..|...:....|        |::: :|       |.
  Fly    93 KFIGLYRGISSPMGGIGLVNA-----IVFGVYGNVQRLSND--------PNSLTSH-------FF 137

  Fly   183 VPLLAGVS-GRILAVTCVSPVELIRTKMQSQRMTHAEMFGT-----IRQVVQSQGVLGLWRGLPP 241
            ...:|||: |.:.|     |:||.:|::|......:.:..|     ::.:|:::|:.|.::||..
  Fly   138 AGSIAGVAQGFVCA-----PMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTA 197

  Fly   242 TILRDVPFSGIYWTCYEYLKSSFGVVEPTFSFSFAAGAISGSVAATITTPFDVVKTHEQIE-FGE 305
            |||||:|....|:..:|||...  |..|..:::..||..:|..:.....|.||||||.|.: .|.
  Fly   198 TILRDIPGFASYFVSFEYLMRQ--VETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGA 260

  Fly   306 K-----FIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAP---ACAIMIS 358
            .     ||       ..|.|.        :|..|....|.||...|.:..|   ||..::|
  Fly   261 NAKYNGFI-------DCAMKG--------FRNEGPQYFFRGLNSTLIRAFPMNAACFFVVS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 20/104 (19%)
Mito_carr 178..265 CDD:278578 27/92 (29%)
Mito_carr 268..371 CDD:278578 27/100 (27%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 20/101 (20%)
PTZ00169 41..295 CDD:240302 74/308 (24%)
Mito_carr 128..218 CDD:278578 30/109 (28%)
Mito_carr 221..304 CDD:278578 26/97 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.