DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and MME1

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:335 Identity:85/335 - (25%)
Similarity:134/335 - (40%) Gaps:69/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAA 103
            |::...:...|.|.......|||.||.|||..                           |.|...
  Fly    14 PVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTM---------------------------PTPPPG 51

  Fly   104 KPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARF-TDIHYKYTRR 167
            :| ||:.|.||...:..|.||....:.|:|..|:...|...:.|..|...|..| ||.|.:.|  
  Fly    52 QP-PRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLT-- 113

  Fly   168 PDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMTHAEMF--GTI---RQVV 227
                     :|..|....||||...::.|    |.:.|:..:|:|.:::..:.  |||   .::.
  Fly   114 ---------YPQIFAAGALAGVCSALVTV----PTDRIKVLLQTQTVSNGPLLYNGTIDTAAKLY 165

  Fly   228 QSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYL------KSSFGVVEPTFSFSFAAGAISGSVAA 286
            :..|:..|::|....||||.| :|.|:..||:|      ||:.|.:..|  .:..:|..:|.|..
  Fly   166 RQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQELARKKSANGKISTT--STILSGGTAGIVFW 227

  Fly   287 TITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAP 351
            |:..||||:|:..|           :.|:......:.....::....|..|:|.|:.|.|.:..|
  Fly   228 TLAVPFDVLKSRLQ-----------SAPEGTYKHGIRSVFRNLMATEGPKALFRGILPILLRAFP 281

  Fly   352 ACAIMISSFE 361
            :.|.:....|
  Fly   282 STAAVFFGVE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 30/120 (25%)
Mito_carr 178..265 CDD:278578 29/97 (30%)
Mito_carr 268..371 CDD:278578 21/94 (22%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 30/120 (25%)
Mito_carr 111..205 CDD:278578 28/109 (26%)
Mito_carr 208..297 CDD:278578 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.