DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and Ucp4A

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:376 Identity:88/376 - (23%)
Similarity:142/376 - (37%) Gaps:81/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASAAMAAASSQNPSKATMTDPRFRIRPLQ---QVASACT------GAMVTACFMTPLDVIKTRLQ 68
            :|.|:|:::|.||:.::   .|.::||::   ..:.|||      .|.:......|||:.|||||
  Fly     8 SSPAVASSTSSNPAPSS---GRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQ 69

  Fly    69 AQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLS 133
            .|.:....                        :|.|...::.|.:.....|:|.||...||.|::
  Fly    70 IQGEGAAH------------------------SAGKSNMQYRGMVATAFGIAREEGALKLWQGVT 110

  Fly   134 PTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTC 198
            |.|...:..:.:...:|:..:..||              .:....:|.....|.||:...:|...
  Fly   111 PALYRHVVYSGVRICSYDLMRKEFT--------------QNGTQALPVWKSALCGVTAGAVAQWL 161

  Fly   199 VSPVELIRTKMQSQRMTHAEMFG----------TIRQVVQSQGVLGLWRGLPPTILRDVPFSGIY 253
            .||.:|:  |:|.|......:.|          ..||:||..|:.|||:|..|.:.|....:...
  Fly   162 ASPADLV--KVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGD 224

  Fly   254 WTCYEYLKSSFG---VVEPTFSFSFAAGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPK 315
            .|.|:.:|....   .:....:....|...:|.|||.:.||.|||||...           |.|.
  Fly   225 LTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIM-----------NQPT 278

  Fly   316 QVATKSVAMR-----LASIYRMGGVPAIFSGLGPRLFKVAPACAIMISSFE 361
            ....:.:..|     |.......|..|::.|..|...::||.......|||
  Fly   279 DENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 28/128 (22%)
Mito_carr 178..265 CDD:278578 26/96 (27%)
Mito_carr 268..371 CDD:278578 25/99 (25%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 79/342 (23%)
Mito_carr 39..138 CDD:278578 28/136 (21%)
Mito_carr 142..239 CDD:278578 26/98 (27%)
Mito_carr 248..336 CDD:278578 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.