DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and Ant2

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:333 Identity:71/333 - (21%)
Similarity:134/333 - (40%) Gaps:69/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTID 114
            |.:....:.|::.:|..||.|                         :.....||.  .|:.|.:|
  Fly    29 AAIAKTAVAPIERVKLILQVQ-------------------------EVSKQIAAD--QRYKGIVD 66

  Fly   115 AFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARF---TDIHYKYTRRPDTIAHDIP 176
            .||:|.:.:|..|.|.|....:|...|:..:.|...:.:|:.|   .|.|.::.|.         
  Fly    67 CFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRH--------- 122

  Fly   177 HPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQ--RMTHAEMFGTI---RQVVQSQGVLGLW 236
                |...|.:|.:....::..|.|::..||::.:.  :..:.|..|.|   .:|::|.|.:||:
  Fly   123 ----FAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLY 183

  Fly   237 RG----LPPTILRDVPFSGIYWTCYEYL---KSSFGVVEPTFSFSFAAGAISGSVAATITTPFDV 294
            ||    :...::....:.|.|.||.::|   ||:      .|..|:|...:..:||...:.|||.
  Fly   184 RGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKST------PFYVSWAIAQVVTTVAGIASYPFDT 242

  Fly   295 VKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAPACAIMISS 359
            |:....::.|.|       ..::..|:.|.....|.:..|:.|.|.|....:.: ....|::::.
  Fly   243 VRRRMMMQSGLK-------KSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLAL 299

  Fly   360 FEYGKSFF 367
            ::..|.:|
  Fly   300 YDEMKKYF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 23/111 (21%)
Mito_carr 178..265 CDD:278578 24/98 (24%)
Mito_carr 268..371 CDD:278578 21/100 (21%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 69/329 (21%)
Mito_carr 17..111 CDD:278578 23/108 (21%)
Mito_carr 119..215 CDD:278578 23/108 (21%)
Mito_carr 218..307 CDD:278578 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.