DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and sesB

DIOPT Version :9

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:315 Identity:65/315 - (20%)
Similarity:124/315 - (39%) Gaps:64/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAK 104
            ::..|:....|.|:...:.|::.:|..||.|                  ||         .....
  Fly    24 VKDFAAGGISAAVSKTAVAPIERVKLLLQVQ------------------HI---------SKQIS 61

  Fly   105 PAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARF---TDIHYKYTR 166
            |..::.|.:|.||:|.:.:|..|.|.|....:|...|:..:.|...:::|..|   .|.:.::.|
  Fly    62 PDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWR 126

  Fly   167 RPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQS------QRMTHAEMFG---T 222
            .             |...|.:|.:....::..|.|::..||::.:      ||    |..|   .
  Fly   127 Y-------------FAGNLASGGAAGATSLCFVYPLDFARTRLAADTGKGGQR----EFTGLGNC 174

  Fly   223 IRQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSFGVVEPT-FSFSFAAGAISGSVAA 286
            :.::.:|.|::||:||...::...:.:...|:..|:..:......:.| ...|:|...:..:||.
  Fly   175 LTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAG 239

  Fly   287 TITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSG 341
            .::.|||.|:....::.|.|       ..:|..|:.....|:|.:..|..|.|.|
  Fly   240 IVSYPFDTVRRRMMMQSGRK-------ATEVIYKNTLHCWATIAKQEGTGAFFKG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/121 (21%)
Mito_carr 178..265 CDD:278578 19/95 (20%)
Mito_carr 268..371 CDD:278578 19/75 (25%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 25/118 (21%)
PTZ00169 23..312 CDD:240302 65/315 (21%)
Mito_carr 124..220 CDD:278578 20/112 (18%)
Mito_carr 223..312 CDD:278578 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.