DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs1 and hypF

DIOPT Version :10

Sequence 1:NP_001027444.1 Gene:Tcs1 / 3772640 FlyBaseID:FBgn0061361 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_417192.1 Gene:hypF / 944963 ECOCYCID:EG11551 Length:750 Species:Escherichia coli


Alignment Length:144 Identity:43/144 - (29%)
Similarity:72/144 - (50%) Gaps:13/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EAALQLARQCLLGGQVIALPTDTVYGLACDANNETAIQQLYEIKGRDEHKPVAICVHNIDALRRF 102
            |||||.|...|..|:::|:.....:.|||||.|..|:..|...|.|.. ||:|:.:...|.|   
E. coli   200 EAALQAAIAQLKMGKIVAIKGIGGFHLACDARNSNAVATLRARKHRPA-KPLAVMLPVADGL--- 260

  Fly   103 GQAAHLSDELLTRLLPGPLTIVIER--TSQLSNRFLNPSTSKIGIRIPDFNFMRDLCAVWQEKPL 165
            ..||.   :|||  .|....:::::  ..:|.:. :.|..:::|:.:| .|.::.|.....:.||
E. coli   261 PDAAR---QLLT--TPAAPIVLVDKKYVPELCDD-IAPDLNEVGVMLP-ANPLQHLLLQELQCPL 318

  Fly   166 ALTSANRSSAPSSL 179
            .:||.|.|..|.::
E. coli   319 VMTSGNLSGKPPAI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs1NP_001027444.1 TsaC 37..228 CDD:439780 43/144 (30%)
hypFNP_417192.1 Acylphosphatase 9..>48 CDD:444972
hypF 42..739 CDD:272929 43/144 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.