DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33832 and HTA6

DIOPT Version :10

Sequence 1:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_200795.1 Gene:HTA6 / 836109 AraportID:AT5G59870 Length:150 Species:Arabidopsis thaliana


Alignment Length:52 Identity:15/52 - (28%)
Similarity:19/52 - (36%) Gaps:10/52 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 CSACG----SSGFAITGDLNLLDNTIMR----TDARYIIIVEKHAIFHRLVE 227
            |..||    |.||......|..|:.|.:    ||..:  ...|...||..:|
plant   430 CHICGKKFKSRGFLKRHMKNHPDHMIKKKYQCTDCDF--TTNKKVSFHNHLE 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399
HTA6NP_200795.1 PLN00157 13..138 CDD:177758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.