DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33832 and H2az2

DIOPT Version :10

Sequence 1:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_030102286.1 Gene:H2az2 / 77605 MGIID:1924855 Length:131 Species:Mus musculus


Alignment Length:107 Identity:20/107 - (18%)
Similarity:30/107 - (28%) Gaps:45/107 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LQEPGKEAVDCSACGSSGFAITGDLNLLDNTIMRTDARYIIIVEKHAIFHRLVEDRVFN--HIPC 236
            |:.|.......||...|..::||.|                        |:..|:.:.:  |.| 
Mouse   102 LEPPATYTTAYSATLPSAISLTGPL------------------------HQCSEEGLLDTPHFP- 141

  Fly   237 VFITAKGYPDIATRFF--------------LHRMSTTFPDLP 264
                ....||::..||              |..:...||..|
Mouse   142 ----RTPTPDLSDPFFSFKVDLGLSLLEEVLQILKEQFPSEP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399
H2az2XP_030102286.1 PLN00154 <30..124 CDD:177756 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.