DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33832 and hist1h2a5

DIOPT Version :10

Sequence 1:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_005163276.2 Gene:hist1h2a5 / 559220 ZFINID:ZDB-GENE-131121-77 Length:268 Species:Danio rerio


Alignment Length:125 Identity:112/125 - (89%)
Similarity:119/125 - (95%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.||||||:||||||||||:||||||||||:|||||||||||||:|||.||:||
Zfish   141 MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILE 205

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||||.|
Zfish   206 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 99/107 (93%)
hist1h2a5XP_005163276.2 PTZ00017 1..128 CDD:185399
PTZ00017 141..268 CDD:185399 112/125 (90%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.