DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33832 and macroh2a2

DIOPT Version :10

Sequence 1:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001006925.1 Gene:macroh2a2 / 448772 XenbaseID:XB-GENE-1015564 Length:372 Species:Xenopus tropicalis


Alignment Length:119 Identity:81/119 - (68%)
Similarity:92/119 - (77%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            ||.|  |||.|....|||.|||:.|||||:.|.||:|.:..|:|.|||||:|||:||||||:|||
 Frog     1 MSAR--GGKKKTTKLSRSARAGVIFPVGRMMRYLRRGTHKYRIGMGAPVYMAAVIEYLAAEILEL 63

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119
            ||||||||||.||.|||:.||:.||||||:||.|||||.|||||.|...||.||
 Frog    64 AGNAARDNKKGRITPRHILLAVANDEELNQLLRGVTIASGGVLPRIHPELLAKK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 74/104 (71%)
macroh2a2NP_001006925.1 H2A 14..119 CDD:197711 74/104 (71%)
Macro_H2A-like 178..368 CDD:394875
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.