DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33632

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:185 Identity:62/185 - (33%)
Similarity:99/185 - (53%) Gaps:18/185 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNVLKIVV---ILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNA 62
            |:..||:.|   ::..:.||  ..||:. :.|||.||:.::.:.....|.|::|||:....:...
  Fly     1 MAIKLKLCVAFQLICIYYLT--EVYSLV-EFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKV 62

  Fly    63 -TIHHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFL--RKPYDMLTKMIYMVFKPFSNINHTC 124
             .:..|...:.:.:...||.|||||:||...:||||||  |.| :.:....|.:||.:|||||||
  Fly    63 KLLKIPVTKIKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNP-NPIALYFYNLFKDYSNINHTC 126

  Fly   125 PFYGDILIRGM------YLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDF 173
            |:..|:::..|      |..|||  :|:|.|.|.|:::|..|...:.:|...:.|
  Fly   127 PYNHDLVLDEMSYHSINYKLTEI--LPFPEGNYKLEVHWIAYDIDRAITTFYFAF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 38/83 (46%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.