DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG13589

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:175 Identity:58/175 - (33%)
Similarity:100/175 - (57%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDV 71
            :|.:::.||:......:   |:||.:|:|.|:|||.::.|||||.:|.:|..|.|||...|..::
  Fly     9 VVSVILGFLVCGEAPLA---KMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNI 70

  Fly    72 VIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGMY 136
            .:..:.:|:.|||||:|:....|.|.|:|:......|:::.:.|..|.:|||||:      .|:.
  Fly    71 YLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPY------EGLQ 129

  Fly   137 LRTEIK----AMPYPSGKYMLQINWSFYKKIQVVTNISYDFIENL 177
            :.::..    .:|.|||.|:|.::|.|..|.|..||:.:.|:|.:
  Fly   130 MLSDFHHIDVPVPLPSGDYLLLLDWIFDFKPQFATNVYFTFVEGM 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 25/79 (32%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.