DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG13589

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:171 Identity:58/171 - (33%)
Similarity:101/171 - (59%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDV 71
            :|.:::.||:......:   |:||.:|:|.|:|||.::.|||||.:|.:|..|.|||...|..::
  Fly     9 VVSVILGFLVCGEAPLA---KMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNI 70

  Fly    72 VIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGMY 136
            .:..:.:|:.|||||:|:....|.|.|:|:......|:::.:.|..|.:|||||:.|..::...:
  Fly    71 YLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFH 135

  Fly   137 LRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIENL 177
             ..:: .:|.|||.|:|.::|.|..|.|..||:.:.|:|.:
  Fly   136 -HIDV-PVPLPSGDYLLLLDWIFDFKPQFATNVYFTFVEGM 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 25/75 (33%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 29/89 (33%)

Return to query results.
Submit another query.