DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG13561

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:158 Identity:51/158 - (32%)
Similarity:78/158 - (49%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FLL--TWR-LSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATI-HHPTNDVVID 74
            |||  .|. |......|.||:.|.|.::::.|::.|||.||.|:....:..|.| ..|...|.:.
  Fly     8 FLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMR 72

  Fly    75 YRFLKRENGYKPWLYKKNI---DGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGMY 136
            .:.||:.:||||:||  ||   |.|.:|.|.......:|...|...:|:| .||...:|::.  :
  Fly    73 MQLLKKASGYKPFLY--NICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLE--H 132

  Fly   137 LRTEIKA---MPYPSGKYMLQINWSFYK 161
            .|..:|.   ||.|.|.|.|...::|::
  Fly   133 FRFPVKVLDMMPLPFGDYGLFTTFTFHR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 28/81 (35%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 27/84 (32%)

Return to query results.
Submit another query.