DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG13561

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:158 Identity:51/158 - (32%)
Similarity:78/158 - (49%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FLL--TWR-LSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATI-HHPTNDVVID 74
            |||  .|. |......|.||:.|.|.::::.|::.|||.||.|:....:..|.| ..|...|.:.
  Fly     8 FLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMR 72

  Fly    75 YRFLKRENGYKPWLYKKNI---DGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGMY 136
            .:.||:.:||||:||  ||   |.|.:|.|.......:|...|...:|:| .||...:|::.  :
  Fly    73 MQLLKKASGYKPFLY--NICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLE--H 132

  Fly   137 LRTEIKA---MPYPSGKYMLQINWSFYK 161
            .|..:|.   ||.|.|.|.|...::|::
  Fly   133 FRFPVKVLDMMPLPFGDYGLFTTFTFHR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 28/81 (35%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.