DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33923

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:149 Identity:44/149 - (29%)
Similarity:80/149 - (53%) Gaps:6/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNA-TIHHPTNDVVIDYRFLKRENGYKPWLYK 90
            :..|:.|.:.:..:...:.|.||||:|.....:... .:..|...:.|:...|:|.|||||:||.
  Fly    25 EFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYN 89

  Fly    91 KNIDGCRFLR-KPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGM---YLRTEI-KAMPYPSGK 150
            ..||.|:|.: :..:.:.:.:|..||.:|||||:||:..||::..:   ::.|:: |.:|.|.|.
  Fly    90 VTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHVNTQVTKVLPVPHGD 154

  Fly   151 YMLQINWSFYKKIQVVTNI 169
            |:...||..|...:.:.::
  Fly   155 YLFHSNWYAYDINRAIVDV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 31/80 (39%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 32/84 (38%)

Return to query results.
Submit another query.