DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33757

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:178 Identity:49/178 - (27%)
Similarity:93/178 - (52%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIH 65
            ::.||..|::|:|.|       .:..|..::.|.:.::|:..|..|::||:||.|...:......
  Fly     2 LAAVLFFVLVLLTPL-------QLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQL 59

  Fly    66 HPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNI-NHTCPFYGD 129
            ...|:|.:.....||.||::|:||..:.:.|.||.|..:::..:.|...||:..: |:||||..:
  Fly    60 RTVNNVHMRLELFKRANGWRPFLYNISFNLCDFLSKRNNVIVSLGYEYLKPYIPMTNYTCPFKKN 124

  Fly   130 ILIRGMYLRTEIK----AMPYPSGKYMLQINWSFYKKIQVVTNISYDF 173
            .||:...|..:|:    ..|..:|:|.||:::...:|:.:..|.|.::
  Fly   125 HLIKCTDLEFDIEKFRVRFPIETGEYALQLSFIVQRKVTLTLNGSAEY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 26/80 (33%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:461928 26/84 (31%)

Return to query results.
Submit another query.