DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33769

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:156 Identity:32/156 - (20%)
Similarity:59/156 - (37%) Gaps:37/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVVID------------------ 74
            :|.||.:|..:......:|     ..||:.|: |.:|......|::|                  
  Fly    16 VTVVIKQSGPRMTFRAGDC-----TYNRSTFS-NFSIQIIKTKVIMDMILVTTLRQGLKAHLSFE 74

  Fly    75 YRFLKRENGYKPW--LYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPF-YGDILIRGMY 136
            :|..|.    ||:  :|:.:::.|..::...:.:.:..:.......|...:||. .|...:.|..
  Fly    75 FRLTKA----KPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCPIREGYYYLHGWT 135

  Fly   137 LRTEIKAMPYPSGKYM--LQINWSFY 160
            |    .|...||..|:  .:|:.|||
  Fly   136 L----DANNVPSFLYLGDYRISGSFY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 15/80 (19%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 17/80 (21%)

Return to query results.
Submit another query.