DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33700

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster


Alignment Length:167 Identity:52/167 - (31%)
Similarity:94/167 - (56%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHH-PTNDV 71
            :||.:.:.|.|.:..:..::|.||||||.:.:....:.|.:|.:.|....|.....::: |...|
  Fly     5 LVIGICWTLLWSIFVAGDFQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSV 69

  Fly    72 VIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPF---SNINHTCPFYGDILIR 133
            .|:....|:.|||:|:|:.:.:|.|.::|.|  ....:|||:.|.|   |||||:||:..|::|.
  Fly    70 DINVALYKKSNGYRPFLFNQTLDFCYYMRNP--RAHPLIYMMHKVFMQASNINHSCPYDHDLIIN 132

  Fly   134 G-MYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNI 169
            . :|.:.::|.:|.|:|.||:::..:|.|:.:....|
  Fly   133 EFIYKKNDLKDLPIPNGDYMIRVKVAFDKEYRTSIKI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 30/79 (38%)
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.