DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33758

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:172 Identity:43/172 - (25%)
Similarity:82/172 - (47%) Gaps:6/172 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVV 72
            ::.|:.|.|....|..|..|..::.|.:.:|.:.....|:|||::|.|...:....:..|.:.:.
  Fly     1 MLALLFFTLLVLTSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIF 65

  Fly    73 IDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPF--YGDILIRGM 135
            |...|.||.||::|:||....:.|.||.:..:::..:.|...:|:...|::|||  ..:.|:...
  Fly    66 IRLEFFKRANGWRPFLYNFTANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLECK 130

  Fly   136 YLRTEIKAM----PYPSGKYMLQINWSFYKKIQVVTNISYDF 173
            ....:|..:    |..:|:|.||:.:....|..:..|.|.::
  Fly   131 DFELDINNLRNRFPIETGEYALQLTFIAKNKAALTINGSIEY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 22/81 (27%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 23/85 (27%)

Return to query results.
Submit another query.