DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33928

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:178 Identity:45/178 - (25%)
Similarity:81/178 - (45%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFN-----FNATI 64
            :.|..::........|..|...:.||:.|.|.::.:.....|.|||.||.....:     :...:
  Fly     6 ITIAGVIYFMFFQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPV 70

  Fly    65 HHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGD 129
            ||.|    ::....||.||..|:......|||:.:....:.:...::.:|||:|||||:||:..|
  Fly    71 HHFT----VNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHD 131

  Fly   130 ILIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNISYDF 173
            |::..:   ::..:. |.:|.|.|.|:...||....|.:.:..:.:.|
  Fly   132 IIVDKLPTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 25/79 (32%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.