DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33687

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:150 Identity:46/150 - (30%)
Similarity:77/150 - (51%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WRLSYSVTYKL--TNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIH-HPTNDVVIDYRFLK 79
            ||::..:|..|  ||:.||..::::.....||:|||||.....:.|..:: .|.|:::|.....:
  Fly     2 WRINVILTSHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLDSKR 66

  Fly    80 RENGYKPWLYKKNIDGCRFLRKPYD---MLTKMIYMVFKPFSNINHTCPFYGDILIR----GMYL 137
            ..|||:|:......|.|::|:.|..   :..|.|:..|...||:|||||:..||.:.    |...
  Fly    67 YTNGYRPFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLE 131

  Fly   138 RTEIKAMPYPSGKYMLQINW 157
            |..::.:|.|:|.|.:...|
  Fly   132 RAFLRYLPVPNGDYAIFSTW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 26/82 (32%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
44.010

Return to query results.
Submit another query.