DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33777

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:171 Identity:51/171 - (29%)
Similarity:89/171 - (52%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNAT-IHHPT 68
            |..::.|:.||.       :..|.||:.|.|.:..:..::.|.||:|||.....:.... :..|.
  Fly     4 LVYLIQLLFFLF-------LVEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPV 61

  Fly    69 NDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKP-YDMLTKMIYMVFKPFSNINHTCPFYGDILI 132
            :.:.::....||.|||||.||...:|.|:|::.| .:.:...||.:||.:||:|:||||..|.::
  Fly    62 SRIKVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIV 126

  Fly   133 RGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNI 169
            ..:   ::..:: ..:|.|||.|:...:|.||...:|..|:
  Fly   127 EKLPISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 30/80 (38%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.