DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33777

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:171 Identity:51/171 - (29%)
Similarity:89/171 - (52%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNAT-IHHPT 68
            |..::.|:.||.       :..|.||:.|.|.:..:..::.|.||:|||.....:.... :..|.
  Fly     4 LVYLIQLLFFLF-------LVEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPV 61

  Fly    69 NDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKP-YDMLTKMIYMVFKPFSNINHTCPFYGDILI 132
            :.:.::....||.|||||.||...:|.|:|::.| .:.:...||.:||.:||:|:||||..|.::
  Fly    62 SRIKVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIV 126

  Fly   133 RGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNI 169
            ..:   ::..:: ..:|.|||.|:...:|.||...:|..|:
  Fly   127 EKLPISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 30/80 (38%)
CG33777NP_001027108.1 DUF1091 66..151 CDD:461928 30/84 (36%)

Return to query results.
Submit another query.