DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33764

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:171 Identity:58/171 - (33%)
Similarity:95/171 - (55%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNA-TIHH 66
            |:....:||:|:.:|  ..|||. |.||:.|:|.::.:...:...||:|||:....:... .:..
  Fly     6 NLFVASLILLTYYIT--EIYSVV-KFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKI 67

  Fly    67 PTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPY-DMLTKMIYMVFKPFSNINHTCPFYGDI 130
            |.:.|.:.:...||.|||.|:||..:.|.||||..|. :.:....|..||.:|||||:|||..||
  Fly    68 PVSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDI 132

  Fly   131 LIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVT 167
            ::..|   .:..:: |.:|:|.||||::::|..|...:.:|
  Fly   133 ILDKMPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAIT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 34/80 (43%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:461928 34/84 (40%)

Return to query results.
Submit another query.