DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33770

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:183 Identity:44/183 - (24%)
Similarity:62/183 - (33%) Gaps:55/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVF-NFNATIHHPT 68
            |:|.:.|...|.:.|...||.:    :..|||                .||..| ||..||.   
  Fly    13 LEIPLCLAIALFSIRAEGSVKF----IAGESR----------------FNRKYFENFTFTIR--- 54

  Fly    69 NDVV-----------------IDYRFLKRENGYKPW--LYKKNIDGCRFLRKPYDMLTKMIYMVF 114
            ||.:                 :|:|  .|....|.:  |:..:||.|..:......|.|..|...
  Fly    55 NDKIFLDMYLRKPLVRGWRARLDFR--TRVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNL 117

  Fly   115 KPFSNINHTCPFYGDILIRGMYLRT----EIKAMPY-PSGKYMLQINWSFYKK 162
            ..:.|....||....    ..|||.    |....|: .||.|.|: .::|:.|
  Fly   118 LKYGNFLRQCPLNAS----HYYLRDWQFGEGLVPPFITSGSYRLE-TYNFFGK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 20/82 (24%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.