DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33648

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:54/176 - (30%)
Similarity:87/176 - (49%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVILVTFLLTWRLSYSVT----YKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNA-TI 64
            |.|||||          |.:.    .:.||:.|.|.:.|:|....||:|:|||.....:.|: .:
  Fly     8 LMIVVIL----------YGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLL 62

  Fly    65 HHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLR-KPYDMLTKMIYMVFKPFSNI-NHTCPFY 127
            ..|..:..|:....||.|||||:||..::|.||||| :..:::.|.::.:....||| :.||||.
  Fly    63 ILPLTNATINVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFN 127

  Fly   128 GDILIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNI 169
            ..|.:..:   :|..:: :.:|.|.|.|:....|..|...:...|:
  Fly   128 SFISVDKLTTNFLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 29/81 (36%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 30/85 (35%)

Return to query results.
Submit another query.