DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33648

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:54/176 - (30%)
Similarity:87/176 - (49%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVILVTFLLTWRLSYSVT----YKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNA-TI 64
            |.|||||          |.:.    .:.||:.|.|.:.|:|....||:|:|||.....:.|: .:
  Fly     8 LMIVVIL----------YGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLL 62

  Fly    65 HHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLR-KPYDMLTKMIYMVFKPFSNI-NHTCPFY 127
            ..|..:..|:....||.|||||:||..::|.||||| :..:::.|.::.:....||| :.||||.
  Fly    63 ILPLTNATINVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFN 127

  Fly   128 GDILIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNI 169
            ..|.:..:   :|..:: :.:|.|.|.|:....|..|...:...|:
  Fly   128 SFISVDKLTTNFLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 29/81 (36%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.