DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33643

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:130 Identity:35/130 - (26%)
Similarity:55/130 - (42%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRF 98
            :|.|:|:|   .|.:..   ||.|..|:|.       .|:|:   .|.||.:..||:..:|.|..
  Fly    49 QSSNRSYV---NCHMLL---NREVGKFDAR-------NVLDF---VRPNGQEMKLYEGRLDACLL 97

  Fly    99 LRK-PYDMLTKMIYMVFKPFSNINHTCPFYGDI--LIRGMYLRTEIKAMPYPSGKYMLQINWSFY 160
            |.. ..:.|..:....||.|||:.  ||...:.  .::.:|:..:......|||.:...|  .||
  Fly    98 LGSIQKNRLVNIYSKTFKRFSNVE--CPLKANFNYTMKNLYMDEQDFPSFVPSGTFRSLI--EFY 158

  Fly   161  160
              Fly   159  158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 20/78 (26%)
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.