DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33752

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:184 Identity:52/184 - (28%)
Similarity:91/184 - (49%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVILVTFLLTWRLSY---SVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFN-FNATIH 65
            ::.::|.|...:|..|..   |:| :.|||.||..::|:.....|:|..:.|.....: :...:.
  Fly     1 MRFIIIRVFCTITLSLEINGESIT-RHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLK 64

  Fly    66 HPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDM-LTKMIYMVFKPFSNINHTCPF--- 126
            .|...:.:::...|:.:||.|:|:...:|.|.:::.|..| :....|...||:||.||:||:   
  Fly    65 LPIKKISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVS 129

  Fly   127 --YGDILIRGMYLR-TEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDF-IEN 176
              |.|||::...|. |....:|.|:|.||..|..:.....:||.|..:|. :||
  Fly   130 ESYHDILVKDFVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDVNVEN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 28/82 (34%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.