DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33654

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:183 Identity:51/183 - (27%)
Similarity:89/183 - (48%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVVILVTFLLT-WRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTND 70
            ||||||..|:. |.   |..::.||:.|.|.::|:.....|.:::.||:                
  Fly     9 IVVILVILLMAKWA---SSKFEFTNLQCTSFDKSFDDFEYCYIRSANRS---------------- 54

  Fly    71 VVIDYRFL---------KRENGYKPWLYKKNIDGCRFLR----KPYDMLTKMIYMVFKPFSNINH 122
                |::|         .|.|||:|:::...:|.||||:    ||   :.|..|..|..:||:||
  Fly    55 ----YKYLTLKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKP---IAKYFYEFFNSYSNLNH 112

  Fly   123 TCPFYGDILIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNISY 171
            :|||..|:::..:   ::...: ..:|:|.|.|:|:.:|..|:..:.:..|.|
  Fly   113 SCPFNHDLIVDKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 28/92 (30%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.