DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33137

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:144 Identity:42/144 - (29%)
Similarity:71/144 - (49%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SVTYKLTNVICE-----SRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVVIDYRFLKRE- 81
            ::.|||.|:.|.     |.|.|      |.::|:|.|:.|...:..:..|..::.|.::.||:: 
  Fly    11 NIVYKLKNIECSTVPGFSANAS------CHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDY 69

  Fly    82 -NGYKPWLYKKNIDGCRFLRK----PYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGMYLRTEI 141
             |.::|:|....|:.|..|.:    ||.::   |..:.:.|||.||:||:.|.::.||.||....
  Fly    70 SNKFQPFLVDVVINMCDALSRRSFIPYGLI---ILKIARTFSNFNHSCPYRGHLMARGAYLNESY 131

  Fly   142 KAMPYPSGKYMLQI 155
            ....:|.|.|...|
  Fly   132 LPNVFPLGFYKFNI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 26/81 (32%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 24/76 (32%)

Return to query results.
Submit another query.