DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG13193

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:156 Identity:37/156 - (23%)
Similarity:68/156 - (43%) Gaps:25/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLSYSVTYKLTNVICE------SRNQSWVTI-NECRLKAVNRNRTVFNFNATIHHPTNDVVIDYR 76
            |...::..|.||:..|      |..:.|:|. .|..|. ::.|||:.|...|       .:...:
  Fly    28 RFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGELNLD-IHLNRTLKNGLRT-------TITLLQ 84

  Fly    77 FLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYM--VFKPFSNINHTCPFY-GDILIRGMYLR 138
            .:..::.|:. |:..::|.|:.||:........:::  ||| :.|:...||.. ....:|...| 
  Fly    85 LIDGKDRYQT-LFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQL- 146

  Fly   139 TEIKAMP--YPSGKYMLQINWSFYKK 162
             |..::|  .|:|.|.|. :.::|.|
  Fly   147 -ENHSIPGYLPAGFYRLH-DTNYYGK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 19/80 (24%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.