DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG13193

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:156 Identity:37/156 - (23%)
Similarity:68/156 - (43%) Gaps:25/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLSYSVTYKLTNVICE------SRNQSWVTI-NECRLKAVNRNRTVFNFNATIHHPTNDVVIDYR 76
            |...::..|.||:..|      |..:.|:|. .|..|. ::.|||:.|...|       .:...:
  Fly    28 RFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGELNLD-IHLNRTLKNGLRT-------TITLLQ 84

  Fly    77 FLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYM--VFKPFSNINHTCPFY-GDILIRGMYLR 138
            .:..::.|:. |:..::|.|:.||:........:::  ||| :.|:...||.. ....:|...| 
  Fly    85 LIDGKDRYQT-LFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQL- 146

  Fly   139 TEIKAMP--YPSGKYMLQINWSFYKK 162
             |..::|  .|:|.|.|. :.::|.|
  Fly   147 -ENHSIPGYLPAGFYRLH-DTNYYGK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 19/80 (24%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 22/85 (26%)

Return to query results.
Submit another query.