DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG13198

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:155 Identity:39/155 - (25%)
Similarity:71/155 - (45%) Gaps:6/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLTNVICES--RNQSWVTINECRLKAVNRNRTVFNFNATIHH-PTNDVVIDYRFLKRENGYKPWL 88
            |.|||.|..  .::.......|.||.|.||:...:...::.. |..::....:..:|.:||:|::
  Fly    26 KFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGYRPFM 90

  Fly    89 YKKNIDGCRFL-RKPYDM-LTKMIYMVFKPFSNINHTCPF-YGDILIRGMYLRTEIKAMPYPSGK 150
            |....|.|:.: .:.||: ..:.|:...:..||.|.|||: ...:.:....|.....:||.|:|.
  Fly    91 YYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKISMPVPAGT 155

  Fly   151 YMLQINWSFYKKIQVVTNISYDFIE 175
            |.|...:..|...:.:|.:.::.||
  Fly   156 YRLGFTFYAYGIARTLTQVFFEKIE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 22/78 (28%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472580
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.