DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33453

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:175 Identity:75/175 - (42%)
Similarity:109/175 - (62%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHH 66
            |||:...|.|....|...:|.:...|||||:|||.|:||...:.|||||.:||:|..|.|||..|
  Fly     3 SNVILPGVFLAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH 67

  Fly    67 PTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGDIL 131
            |||:|.:..:.:||.:||||:|:...||.|:||||.::.:.||.|...|.:|.:||||| ||..:
  Fly    68 PTNNVSLRLKMVKRLSGYKPFLFDVTIDACQFLRKRHNPVIKMFYSFIKDYSTLNHTCP-YGLQV 131

  Fly   132 IRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIEN 176
            :...:  |.:..:|.|||.|.:.:::.||.|.|...||.::|:|:
  Fly   132 VSDYH--TAVFPVPLPSGDYGVLLDFIFYAKKQFHVNIYFNFVED 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 32/75 (43%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.