DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33463

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:158 Identity:53/158 - (33%)
Similarity:85/158 - (53%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVTFLLTWRLSYSVTYKL--TNVICESRNQSWVTINECRLKAVNRNRTVFNFN-ATIHHPTNDV 71
            :|:|..|..:|:...|..|  .|:.||:.::.:.....|.||:|||.....:.. ..:..|..:.
  Fly     7 LLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNA 71

  Fly    72 VIDYRFLKRENGYKPWLYKKNIDGCRFLRKP-YDMLTKMIYMVFKPFSNINHTCPFYGDILI--- 132
            .::....:|.|||||:||...:|.|:.::.| |..:....:..||.|||:||:|||..||::   
  Fly    72 KVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKL 136

  Fly   133 --RGMYLR-TEIKAMPYPSGKYMLQINW 157
              :.:|.| |.|  :|:|.|.||||:||
  Fly   137 TAKSVYHRMTNI--LPFPEGDYMLQLNW 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 32/82 (39%)
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.