DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33467

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:159 Identity:40/159 - (25%)
Similarity:72/159 - (45%) Gaps:23/159 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TWRLSYSV-----------TYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTND 70
            ||.:..|:           .||.|.|.|:. ||:.|....|.:|.:|.|..:.|.:..:.:|..:
  Fly     4 TWLVLLSICFIGHMTDSQLVYKFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYLIYPLIN 67

  Fly    71 VVIDYRFLKRE--NGYKPWLYKKNIDGCRFLRK----PYDMLTKMIYMVFKPFSNINHTCPFYGD 129
            ..|..:...::  |.|||:|.......|..:.:    ||.:   |::.:|:.|:|:. :|...|.
  Fly    68 PTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAV---MVWELFQRFTNVK-SCHISGQ 128

  Fly   130 ILIRGMYLRTEIKAMPYPSGKYMLQINWS 158
            :..|..||.:.. ..|:|.|:|.:.:.:|
  Fly   129 LSARNGYLNSSY-VPPFPHGQYQISVMFS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 21/81 (26%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 22/85 (26%)

Return to query results.
Submit another query.