DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33483

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:157 Identity:48/157 - (30%)
Similarity:82/157 - (52%) Gaps:10/157 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHH-PTNDVVIDYRFLKRENGYKPWLYK 90
            :.||:.|.|.::::.....|.||:|||:....:....:|. |...|.:::..|||.|||||:||.
  Fly    76 EFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLYN 140

  Fly    91 KNIDGCRFLR-KPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGM---YLRTEIKA-MPYPSGK 150
            ..:|.|:.|| ..|:.:....|.:||..||:||||||..|:::..:   ::..::.. :.:|.|.
  Fly   141 ITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKFPHGD 205

  Fly   151 YMLQINWSFYKKIQVVTNISYDFIENL 177
            |:...:|..|.    :...:.||...|
  Fly   206 YLFHSDWYAYG----INRATVDFFLTL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 30/80 (38%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.